Protein Info for EFB2_03312 in Escherichia fergusonii Becca

Annotation: putative multidrug ABC transporter permease YbhS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 347 to 370 (24 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 14 to 368 (355 residues), 68.5 bits, see alignment E=8.9e-23 PF12698: ABC2_membrane_3" amino acids 29 to 370 (342 residues), 134.7 bits, see alignment E=6.4e-43 PF01061: ABC2_membrane" amino acids 169 to 341 (173 residues), 79.2 bits, see alignment E=5.1e-26

Best Hits

Swiss-Prot: 100% identical to YBHS_ECOLI: Probable multidrug ABC transporter permease YbhS (ybhS) from Escherichia coli (strain K12)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to eco:b0793)

MetaCyc: 100% identical to ABC exporter membrane subunit YbhS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-366 [EC: 7.6.2.2]

Predicted SEED Role

"ABC transport system, permease component YbhS"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>EFB2_03312 putative multidrug ABC transporter permease YbhS (Escherichia fergusonii Becca)
MSNPILSWRRVRALCVKETRQIVRDPSSWLIAVVIPLLLLFIFGYGINLDSSKLRVGILL
EQRSEAALDFTHTMTGSPYIDATISDNRQELIAKMQAGKIRGLVVIPVDFAEQMERANAT
APIQVITDGSEPNTANFVQGYVEGIWQIWQMQRAEDNGQTFEPLIDVQTRYWFNPAAISQ
HFIIPGAVTIIMTVIGAILTSLVVAREWERGTMEALLSTEITRTELLLCKLIPYYFLGML
AMLLCMLVSVFILGVPYRGSLLILFFISSLFLLSTLGMGLLISTITRNQFNAAQVALNAA
FLPSIMLSGFIFQIDSMPAVIRAVTYIIPARYFVSTLQSLFLAGNIPVVLVVNVLFLIAS
AVMFIGLTWLKTKRRLD