Protein Info for EFB2_03149 in Escherichia fergusonii Becca

Annotation: Tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF02606: LpxK" amino acids 13 to 320 (308 residues), 385.9 bits, see alignment E=8e-120 TIGR00682: tetraacyldisaccharide 4'-kinase" amino acids 19 to 322 (304 residues), 413.4 bits, see alignment E=2.9e-128

Best Hits

Swiss-Prot: 99% identical to LPXK_ECOLU: Tetraacyldisaccharide 4'-kinase (lpxK) from Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 98% identity to eco:b0915)

MetaCyc: 98% identical to tetraacyldisaccharide 4'-kinase (Escherichia coli K-12 substr. MG1655)
Tetraacyldisaccharide 4'-kinase. [EC: 2.7.1.130]

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>EFB2_03149 Tetraacyldisaccharide 4'-kinase (Escherichia fergusonii Becca)
MIEKIWSGESPLWRLLLPLSWLYGLVSGAIRLCYKLKLKRAWRAPIPVVVVGNLTAGGNG
KTPVVVWLVEQLQQRGIRVGVVSRGYGGKAESYPLLLSADTTTAQAGDEPVLIYQRTGAP
VAVSPVRSDAVNAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGVRRFGNGWWLPAGP
MRERAGRLKSVDAVIVNGGVPRSGEIPMHLLPGQAVNLRTGTRCDVAQLEHVVAMAGIGH
PPRFFATLKMCGVQPEKCVPLADHQSLNHADVSALVSAGQTLVMTEKDAVKCRAFAEENW
WYLPVDAQLSGDEPAKLLAQLTSLASGN