Protein Info for EFB2_03103 in Escherichia fergusonii Becca

Annotation: Acylphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to ACYP_ECOK1: Acylphosphatase (yccX) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K01512, acylphosphatase [EC: 3.6.1.7] (inferred from 96% identity to eco:b0968)

MetaCyc: 96% identical to acylphosphatase (Escherichia coli K-12 substr. MG1655)
Acylphosphatase. [EC: 3.6.1.7]

Predicted SEED Role

"Acylphosphate phosphohydrolase (EC 3.6.1.7), putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 3.6.1.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (92 amino acids)

>EFB2_03103 Acylphosphatase (Escherichia fergusonii Becca)
MSKVCIIAWIYGRVQGVGFRYTTQYEAKKLGLTGYAKNLDDGSVEVVACGDEGQVEKLIQ
WLKSGGPRSARVERVLSEPHHPSGELTDFRIR