Protein Info for EFB2_03103 in Escherichia fergusonii Becca
Annotation: Acylphosphatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ACYP_ECOK1: Acylphosphatase (yccX) from Escherichia coli O1:K1 / APEC
KEGG orthology group: K01512, acylphosphatase [EC: 3.6.1.7] (inferred from 96% identity to eco:b0968)MetaCyc: 96% identical to acylphosphatase (Escherichia coli K-12 substr. MG1655)
Acylphosphatase. [EC: 3.6.1.7]
Predicted SEED Role
"Acylphosphate phosphohydrolase (EC 3.6.1.7), putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 3.6.1.7)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.6.1.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (92 amino acids)
>EFB2_03103 Acylphosphatase (Escherichia fergusonii Becca) MSKVCIIAWIYGRVQGVGFRYTTQYEAKKLGLTGYAKNLDDGSVEVVACGDEGQVEKLIQ WLKSGGPRSARVERVLSEPHHPSGELTDFRIR