Protein Info for EFB2_03028 in Escherichia fergusonii Becca

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 33 to 49 (17 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecc:c1198)

Predicted SEED Role

"FIG017861: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>EFB2_03028 hypothetical protein (Escherichia fergusonii Becca)
MSGIRSLPMIKLLTGLLLLVWPFLIWLGLVHNSLHWLLPLMALLLLLRLRQPRRQTGLLQ
VVTKIVAVVGIVLCVSSFLLKTYQLLLFYPVVVNAVMLAVFGGSLRSTMPIVERLARLQE
PDLPEKAVRYTRRVTQVWCLFFIFNGSIALFTTLYGNMPLWTAWNGIIAYLLIGFLTAGE
WLIRRKMIKRKTP