Protein Info for EFB2_02981 in Escherichia fergusonii Becca

Annotation: S-fimbrial adhesin protein SfaS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00419: Fimbrial" amino acids 28 to 162 (135 residues), 38.2 bits, see alignment E=9.2e-14

Best Hits

Swiss-Prot: 72% identical to SFAS_ECOL5: S-fimbrial adhesin protein SfaS (sfaS) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: None (inferred from 72% identity to ecp:ECP_0298)

Predicted SEED Role

"F1C minor fimbrial subunit protein G presursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>EFB2_02981 S-fimbrial adhesin protein SfaS (Escherichia fergusonii Becca)
MKLKAIILATGLINCIAFSAQAVDSTITVTGNVLQRTCTTPKDINVPLGNLYTTDFPATG
STSQWKTFSLSLTNCQNTGRVQASFAGTQDGSGYFANNGSAGNIKIEIGDADVSSVTYGP
NTIKTVSVQNNNATFNLKARAVSKGQVTPGDISSVITVTYTYS