Protein Info for EFB2_02960 in Escherichia fergusonii Becca

Annotation: Secretory immunoglobulin A-binding protein EsiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details PF08238: Sel1" amino acids 43 to 77 (35 residues), 42.1 bits, see alignment 8.9e-15 amino acids 78 to 113 (36 residues), 39 bits, see alignment 8.5e-14 amino acids 115 to 149 (35 residues), 44.2 bits, see alignment 1.9e-15 amino acids 151 to 185 (35 residues), 38.2 bits, see alignment 1.4e-13 amino acids 186 to 220 (35 residues), 37.7 bits, see alignment 2.2e-13 amino acids 222 to 256 (35 residues), 46.8 bits, see alignment 2.8e-16 amino acids 258 to 293 (36 residues), 47.6 bits, see alignment 1.6e-16 amino acids 295 to 329 (35 residues), 49.6 bits, see alignment 3.7e-17 amino acids 330 to 364 (35 residues), 27.3 bits, see alignment 4e-10

Best Hits

KEGG orthology group: K07126, (no description) (inferred from 100% identity to ecc:c1269)

Predicted SEED Role

"FIG00639943: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>EFB2_02960 Secretory immunoglobulin A-binding protein EsiB (Escherichia fergusonii Becca)
MGKIKYWLIVGFIILFAIFYIAISDRDSTLSRLKSAGENGDVEAQYALGLMYLYGEILDV
DYQQAKIWYEKAADQNDPRAQAKLGVMYANGLGVNQDYQQSKLWYEKAAAQNDVDAQFLL
GEMYDDGLGVSQDYQHAKMWYEKAAAQNDERAQVNLAVLYAKGNGVEQDYRQAKSWYEKA
AAQNSPDAQFALGILYANANGVEQDYQQAKDWYEKAAEQNFANAQFNLGMLYYKGEGVKQ
NFRQAREWFEKAASQNQPNAQYNLGQIYYYGQGVTQSYRQAKDWFEKAAEKGHVDAQYNL
GVIYENGEGVSQNYQQAKAWYEKAASQNDAQAQFELGVMNELGQGESIDLKQARHYYERS
CNNGLKKGCERLKELLYK