Protein Info for EFB2_02932 in Escherichia fergusonii Becca

Annotation: Minor curlin subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07012: Curlin_rpt" amino acids 53 to 86 (34 residues), 36.5 bits, see alignment 1.8e-13 amino acids 75 to 106 (32 residues), 37.8 bits, see alignment 7.2e-14 amino acids 97 to 130 (34 residues), 37.6 bits, see alignment 8.4e-14

Best Hits

Swiss-Prot: 99% identical to CSGB_ECOLI: Minor curlin subunit (csgB) from Escherichia coli (strain K12)

KEGG orthology group: K04335, minor curlin subunit (inferred from 99% identity to eco:b1041)

Predicted SEED Role

"Minor curlin subunit CsgB, nucleation component of curlin monomers" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>EFB2_02932 Minor curlin subunit (Escherichia fergusonii Becca)
MKNKLLFMMLTILGAPGIAAAAGYDLANSEYNFAVNELSKSSFNQAAIIGQAGTNNSAQL
RQGGSKLLAVVAQEGSSNRAKIDQTGDYNLAYIDQAGNANDASISQGAYGNTAMIIQKGS
GNKANITQYGTQKTAIVVQRQSQMAIRVTQR