Protein Info for EFB2_02899 in Escherichia fergusonii Becca

Annotation: Basal-body rod modification protein FlgD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF03963: FlgD" amino acids 7 to 78 (72 residues), 83 bits, see alignment E=2e-27 PF13861: FLgD_tudor" amino acids 87 to 228 (142 residues), 53.3 bits, see alignment E=4e-18 PF13860: FlgD_ig" amino acids 120 to 189 (70 residues), 80.1 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 99% identical to FLGD_ECOLI: Basal-body rod modification protein FlgD (flgD) from Escherichia coli (strain K12)

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 99% identity to eco:b1075)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>EFB2_02899 Basal-body rod modification protein FlgD (Escherichia fergusonii Becca)
MSIAVTTTDPTNTGVSTTSSSSLTGSNASDLQSSFLTLLVAQLKNQDPTNPMENNELTSQ
LAQISTVSGIEKLNTTLGSISGQIDNSQSLQASNLIGHGVMIPGTTVLAGTGSEEGAVTT
TTPFGVELQQAADKVTATITDKNGAVVRTIDIGELTAGVHSFTWDGTLTDGSTAPNGSYN
VAISASNGGTQLVAQPLQFALVQGVIRGNNGNTLDLGTYGTTTLDEVRQII