Protein Info for EFB2_02779 in Escherichia fergusonii Becca

Annotation: Manganese transport system membrane protein MntB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 56 to 82 (27 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details PF00950: ABC-3" amino acids 10 to 265 (256 residues), 257.6 bits, see alignment E=7e-81

Best Hits

Swiss-Prot: 53% identical to YFED_YERPE: Chelated iron transport system membrane protein YfeD (yfeD) from Yersinia pestis

KEGG orthology group: K11606, manganese/iron transport system permease protein (inferred from 99% identity to ecp:ECP_1189)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>EFB2_02779 Manganese transport system membrane protein MntB (Escherichia fergusonii Becca)
MMALLLEPLQFTFMSHALLISLVVSIPCALLSVFLVLKGWALMGDAMSHAVFPGIVLAWI
LGLPLATGAFVAGVFCAVATGYLKDNSRIKQDTVMGIVFSGMFAAGLILYIAVKPDVHLD
HILFGDMLGITIGDIIQTMIIAGLVTLVISVKWRDFLLFSFDYQQAQVSGLHTRWLHYGL
LCMVSLTIVATLKAVGIILSISLLIAPGAIAVLLTQRFHIALLLATGISVIVSMTGVWLS
FFIDSAPAPTIVVLFAVLFIMTFAVTSINARKKGNSHTQDLLSPN