Protein Info for EFB2_02749 in Escherichia fergusonii Becca
Annotation: Protein UmuD
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to UMUD_SHIFL: Protein UmuD (umuD) from Shigella flexneri
KEGG orthology group: K03503, DNA polymerase V [EC: 3.4.21.-] (inferred from 99% identity to eco:b1183)MetaCyc: 99% identical to DNA polymerase V protein UmuD (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]
Predicted SEED Role
"Error-prone repair protein UmuD"
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.7.7.7, 3.4.21.-
Use Curated BLAST to search for 2.7.7.7 or 3.4.21.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (139 amino acids)
>EFB2_02749 Protein UmuD (Escherichia fergusonii Becca) MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKTSGDS MIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPIIIS SEDTLDVFGVVIHVVKAMR