Protein Info for EFB2_02655 in Escherichia fergusonii Becca

Annotation: putative protease SohB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details PF08496: Peptidase_S49_N" amino acids 2 to 158 (157 residues), 201.6 bits, see alignment E=9.8e-64 PF01972: SDH_sah" amino acids 133 to 208 (76 residues), 23.2 bits, see alignment E=4.9e-09 PF01343: Peptidase_S49" amino acids 161 to 310 (150 residues), 174.4 bits, see alignment E=2.5e-55

Best Hits

Swiss-Prot: 99% identical to SOHB_ECOLI: Probable protease SohB (sohB) from Escherichia coli (strain K12)

KEGG orthology group: K04774, serine protease SohB [EC: 3.4.21.-] (inferred from 99% identity to eco:b1272)

Predicted SEED Role

"Possible protease sohB (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>EFB2_02655 putative protease SohB (Escherichia fergusonii Becca)
MELLSEYGLFLAKIVTVVLAIAAIAAIIVNVAQRNKRQRGELRVNNLSEQYKEMKEELAA
ALMDSHQQKQWHKAQKKKHKQEAKAAKAKAKLGEVVTDSKPRVWVLDFKGSMDAHEVNSL
REEITAVLAAFKPQDQVVLRLESPGGMVHGYGLAASQLQRLRDKNIPLTVTVDKVAASGG
YMMACVADKIVSAPFAIVGSIGVVAQMPNFNRFLKSKDIDIELHTAGQYKRTLTLLGENT
EEGREKFREELNETHQLFKDFVKRMRSSLDIEQVATGEHWYGQQAVEKGLVDEINTSDEV
ILSLMEGREVVNVRYMQRKRLIDRFTGSAAESADRLLLRWWQRGQKPLM