Protein Info for EFB2_02590 in Escherichia fergusonii Becca

Annotation: Colistin resistance protein EmrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details PF00529: CusB_dom_1" amino acids 22 to 340 (319 residues), 31.5 bits, see alignment E=2.7e-11 PF16576: HlyD_D23" amino acids 46 to 289 (244 residues), 60 bits, see alignment E=4.2e-20 PF13533: Biotin_lipoyl_2" amino acids 48 to 93 (46 residues), 54.8 bits, see alignment 1.3e-18 PF13437: HlyD_3" amino acids 213 to 332 (120 residues), 51 bits, see alignment E=4.2e-17

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to ecp:ECP_1391)

Predicted SEED Role

"multidrug resistance protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>EFB2_02590 Colistin resistance protein EmrA (Escherichia fergusonii Becca)
MIISKKQLIGVVAIGILLAGVVFFIWWVSKGRFIQTTDDAYIGGNITTVASKVSGYISAI
EVRDNQSVKKGDIILRLDDRDYRANVARLEAKIKSSKANLESIQATIAMQQSIIQSASET
WQAVKHEEQKRLRDTERYEKLAQSAAISQQIIDNARFDYQQVAAKERKAANDFLVEKQRL
AVLSAQEENVRASIEEVQAALTQALLDLEYTLVRAPIDGIVANRSAHTGSWVEGGTSLVS
LVPVSELWVDANYKENQIAGMKPGMKAEIRADILKGEVFHGHIESLSPATGASFSLIPIE
NATGNFTKIVQRVPVRIAFDDAKELKQLLRPGLSVTVSVDER