Protein Info for EFB2_02508 in Escherichia fergusonii Becca

Annotation: Oxygen sensor protein DosP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 799 TIGR00229: PAS domain S-box protein" amino acids 18 to 126 (109 residues), 75.1 bits, see alignment E=5.5e-25 amino acids 141 to 256 (116 residues), 52.6 bits, see alignment E=4.9e-18 PF00989: PAS" amino acids 24 to 124 (101 residues), 37.2 bits, see alignment E=9e-13 amino acids 142 to 248 (107 residues), 34.7 bits, see alignment E=5.4e-12 PF13426: PAS_9" amino acids 24 to 124 (101 residues), 52 bits, see alignment E=2.5e-17 amino acids 148 to 250 (103 residues), 45.1 bits, see alignment E=3.7e-15 PF08448: PAS_4" amino acids 142 to 253 (112 residues), 37.6 bits, see alignment E=7.8e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 373 to 526 (154 residues), 51.2 bits, see alignment E=1.2e-17 PF00990: GGDEF" amino acids 378 to 525 (148 residues), 74.2 bits, see alignment E=3.8e-24 PF00563: EAL" amino acids 547 to 781 (235 residues), 233.2 bits, see alignment E=1.1e-72

Best Hits

Swiss-Prot: 98% identical to DOSP_ECOLI: Oxygen sensor protein DosP (dosP) from Escherichia coli (strain K12)

KEGG orthology group: K13243, c-di-GMP-specific phosphodiesterase [EC: 3.1.4.52] (inferred from 99% identity to ecv:APECO1_618)

MetaCyc: 98% identical to oxygen-sensing c-di-GMP phosphodiesterase DosP (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

"Heme-regulated cyclic AMP phosphodiesterase (EC 3.1.4.-)" in subsystem Putative hemin transporter or cAMP signaling in bacteria (EC 3.1.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.-, 3.1.4.52

Use Curated BLAST to search for 3.1.4.- or 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (799 amino acids)

>EFB2_02508 Oxygen sensor protein DosP (Escherichia fergusonii Becca)
MKLTDADNAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDML
IPRDLRPAHPQYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLA
LVRDASVEMAQKEQTRQLIIAVDHLDRPVIVLDPERHIVQCNRAFTEMFGYCINEASGMQ
PDTLLNIPEFPADNRIRLQQLLWKTARDQDEFLLLTRTGEKIWIKASISPVYDVLAHLQN
LVMTFSDITEERQIRQLEGNILAAMCSSPPFHEMGEIICRNIESVLNESHVSLFALRNGM
PIHWASSSHGAEVQNAQSWSATIRQRDGAPAGILQIKTSSGAETSAFIERVADISQHMAA
LALEQEKSRQHIEQLIQFDPMTGLPNRNNLHNYLDDLVDKAISPVVYLIGVDHIQDVIDS
LGYAWADQALLEVVNRFREKLKPDQYLCRIEGASFVLVSLENDVSNITQISDELRNVVSK
PIMIDDKPFPLTLSIGISYDEGKNRDYLLSTAHNAMDFIRKNGGNGWQFFSPAMNEMVKE
RLVLGAALKEAISNNQLKLVYQPQIFAETGELYGIEALARWYDPLHGHVPPSRFIPLAEE
IGEIENIGRWVIAEACRQLAEWRSQNIHIPALSVNLSALHFRSNQLPNQVSDAMHAWGID
GHQLTVEITESMMMEHDTEIFKRIQILRDMGIGLSVDDFGTGFSGLSRLVSLPVTEIKID
KSFVDRCLTEKRILALLEAITSIGQSLNLTVVAEGIETKEQFEMLRKIHCRVIQGYFFSR
PLPAEEIPGWMSSVLPLKI