Protein Info for EFB2_02454 in Escherichia fergusonii Becca

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 218 to 240 (23 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details PF05707: Zot" amino acids 4 to 196 (193 residues), 92.5 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: K10954, zona occludens toxin (inferred from 99% identity to eci:UTI89_C1726)

Predicted SEED Role

"putative phage-related membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>EFB2_02454 hypothetical protein (Escherichia fergusonii Becca)
MAISAYIGIPGSGKSYEAVCNVIIPAFTSGRRVVTNIYGLQKDKITERYPDATGEIIVVD
NDDVLKADFFPFKGGEGSFCQFGDLIVIDEAWRIFGSDKDMTAEKKSFIAEHRHFTHPET
GISCDLVIVNQSLSNIARFLKDKIETTYRMRKLKALGLNNHYCIDVYSGHKIYKSNLVTS
YRNKYNPDIFELYKSYEGNNGNEKQTDKRQSIWNSGKVRFFLVLFPLMFIGSGWLIYSFF
STFGRSDPSPDLTTTDVRDAAMFRSSAVTPASDTPSEPAEPPLSTEWRISGRMTSEGRAF
VILVNGAGVLRAVPASSFNYKGMLMSGIIDGERVTLYTGKK