Protein Info for EFB2_02438 in Escherichia fergusonii Becca

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details PF00990: GGDEF" amino acids 303 to 461 (159 residues), 140.3 bits, see alignment E=2.4e-45 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 303 to 463 (161 residues), 130 bits, see alignment E=3.6e-42

Best Hits

KEGG orthology group: None (inferred from 99% identity to eci:UTI89_C1741)

Predicted SEED Role

"FIG00638480: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>EFB2_02438 hypothetical protein (Escherichia fergusonii Becca)
MHVQPISTFRLFQEGHLLRNSIAIFVLTTLFYFIGAELRLVHELSLFWPLNGVMAGVFAR
YVWLNRLHYYAISYVAMLVYDAITTEWGLVSLAINFSNMMFIVTVALLVARDKRLGKNKY
EPVIALRLFNYCLLAALLCAIVGAIGSVSIDSLDFWPLLADWFSEQFSTGVLIVPCMLTL
AIPGVLPRFKAEQMMPAIALIVSVIASVVIGGAGSLAFPLPALIWCAVRYTPQVTCLLTF
VTGAVEVVLVANSVIDISVGSPFSIPQMFSARLGIATMAICPIMVSFSVAAINSLMKQVA
LRADFDFLTQVYSRSGLYEALKSPSLKQTQHLTVMLLDIDYFKSINDNYGHECGDKVLSV
FAQHIQKIVGDKGLVARMGGEEFAVAVPSVNPVDGLLMAEKIRKGVELQPFTWQQKTLYL
TVSIGVGSGCASYRTLTDDFNKLMVEADTCLYRSKKDGRNRTSTMRYGEEVV