Protein Info for EFB2_02306 in Escherichia fergusonii Becca

Annotation: 1,4-dihydroxy-2-naphthoyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 TIGR00369: uncharacterized domain 1" amino acids 20 to 134 (115 residues), 158 bits, see alignment E=4.8e-51 PF03061: 4HBT" amino acids 50 to 127 (78 residues), 66.6 bits, see alignment E=1e-22

Best Hits

Swiss-Prot: 99% identical to MENI_ECOLI: 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (menI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1686)

MetaCyc: 99% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]

Predicted SEED Role

"1,4-dihydroxy-2-naphthoyl-CoA hydrolase (EC 3.1.2.28) in menaquinone biosynthesis" (EC 3.1.2.28)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>EFB2_02306 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia fergusonii Becca)
MIWKRKITLEALNAMGEGNMVGLLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVV
LAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFD
EKGRLCCSSRLTTAIL