Protein Info for EFB2_02218 in Escherichia fergusonii Becca

Annotation: D-arabitol-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF08240: ADH_N" amino acids 25 to 132 (108 residues), 79.5 bits, see alignment E=4e-26 PF16912: Glu_dehyd_C" amino acids 166 to 352 (187 residues), 55.3 bits, see alignment E=1.3e-18 PF00107: ADH_zinc_N" amino acids 185 to 316 (132 residues), 104.8 bits, see alignment E=6.8e-34

Best Hits

Swiss-Prot: 99% identical to YDJL_ECOLI: Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjL (ydjL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1776)

Predicted SEED Role

"Putative oxidoreductase YdjL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>EFB2_02218 D-arabitol-phosphate dehydrogenase (Escherichia fergusonii Becca)
MKALARFGKAFGGYKMIDVPQPICGPEDVVIEIKAAAICGADMKHYNVDSGSDEFNSIRG
HEFAGCIAQVGEKVKDWKVGQRVVSDNSGHVCGVCPACEQGDFLCCAEKVNLGLDNNTLG
GGFSKYCLVPGEILKIHRHALWEIPDGVDYEDAAVLDPICNAYKSIAQQSKFLPGQDVVV
IGTGPLGLFSVQMARIMGAVNIVVVGLQEDVAVRFPVAKELGATAVVNGSTEDVVARCQQ
ICGKDNLGLVIECSGANIALKQAIEMLRPNGEVVRVGMGFKPLDFSINDITAWNKSIIGH
MAYDSTSWRNAIRLLASGAIKVKPMITHRIGLSQWREGFDAMVDKTAIKVIMTYDFDE