Protein Info for EFB2_02063 in Escherichia fergusonii Becca

Annotation: Flagellar biosynthetic protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 188 to 213 (26 residues), see Phobius details PF01312: Bac_export_2" amino acids 6 to 346 (341 residues), 427.1 bits, see alignment E=2.7e-132 TIGR00328: flagellar biosynthetic protein FlhB" amino acids 6 to 353 (348 residues), 470.2 bits, see alignment E=2.2e-145

Best Hits

Swiss-Prot: 100% identical to FLHB_ECOLI: Flagellar biosynthetic protein FlhB (flhB) from Escherichia coli (strain K12)

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 100% identity to eco:b1880)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>EFB2_02063 Flagellar biosynthetic protein FlhB (Escherichia fergusonii Becca)
MSDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGML
SAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVAIISPVMLGGLVFSGKSL
QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT
AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK
GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI
REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWRLAGGQRP
VQPTHLPVPEALDFINEKPTHE