Protein Info for EFB2_02026 in Escherichia fergusonii Becca

Annotation: D-cysteine desulfhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01275: pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family
  • amino acids 12 to 259 (248 residues), 361.3 bits, E=2.4e-112
• PF00291: PALP
  • amino acids 16 to 256 (241 residues), 130.8 bits, E=3.4e-42

Predicted SEED Role

"D-cysteine desulfhydrase (EC 4.4.1.15)" (EC 4.4.1.15)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• D-serine degradation (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-tryptophan degradation II (via pyruvate) (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-cysteine degradation II (2/3 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• glycine betaine degradation III (4/7 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)

KEGG Metabolic Maps

• Cysteine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.15

Use Curated BLAST to search for 4.4.1.15

Protein Sequence (271 amino acids)

>EFB2_02026 D-cysteine desulfhydrase (Escherichia fergusonii Becca)
MPLHNLTRFPRLEFIGAPTPLEYLPRFSDYLGREIFIKRDDVTPMAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENFLTNGNRLLLD
LFNTQIEMCDALTDPNTQLEELATRVEAQGFRPYVIPVGGSNALGALGYVESALEIAQQC
EGAVNISSVVVASGSAGTHAGLAVGLEHLMPESELIGVTVSRSVADQLPKVVNLQQAIAK
ELELTASAEILLWDDYLHLATACRTTKAWKQ