Protein Info for EFB2_01848 in Escherichia fergusonii Becca

Annotation: Inner membrane protein YeeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 120 to 136 (17 residues), see Phobius details amino acids 142 to 143 (2 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details PF04632: FUSC" amino acids 20 to 316 (297 residues), 63.5 bits, see alignment E=1.7e-21 PF13515: FUSC_2" amino acids 33 to 158 (126 residues), 52 bits, see alignment E=8.1e-18

Best Hits

Swiss-Prot: 99% identical to YEEA_ECOLI: Inner membrane protein YeeA (yeeA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b2008)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>EFB2_01848 Inner membrane protein YeeA (Escherichia fergusonii Becca)
MRADKSLSPFEIRVYRHYRIVHGTRVALAFLLTFLIIRLFTIPESTWPLVTMVVIMGPIS
FWGNVVPRAFERIGGTVLGSILGLIALQLELISLPLMLVWCAAAMFLCGWLALGKKPYQG
LLIGVTLAIVVGSPTGEIDTALWRSGDVILGSLLAMLFTGIWPQRAFIHWRIQLAKSLTE
YNRVYQSAFSPNLLERPRLESHLQKLLTDAVKMRGLIAPASKETRIPKSIYEGIQTINRN
LVCMLELQINAYWATRPSHFVLLNAQKLRDTQHMMQQILLSLVHALYEGNPQPVFSNTEK
LNDAVEELRQLLDNHHDLKVVETPIYGYVWLNMETAHQLELLSNLICRALRK