Protein Info for EFB2_01821 in Escherichia fergusonii Becca

Annotation: UDP-glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR04130: UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase" amino acids 1 to 337 (337 residues), 765.3 bits, see alignment E=2.7e-235 PF05368: NmrA" amino acids 5 to 197 (193 residues), 32.7 bits, see alignment E=2.7e-11 PF02719: Polysacc_synt_2" amino acids 7 to 282 (276 residues), 351.2 bits, see alignment E=2e-108 PF04321: RmlD_sub_bind" amino acids 7 to 126 (120 residues), 35 bits, see alignment E=4e-12 PF01370: Epimerase" amino acids 8 to 222 (215 residues), 85.7 bits, see alignment E=1.5e-27 PF01073: 3Beta_HSD" amino acids 8 to 130 (123 residues), 70.6 bits, see alignment E=5.3e-23 PF16363: GDP_Man_Dehyd" amino acids 8 to 233 (226 residues), 56.7 bits, see alignment E=1.3e-18 PF07993: NAD_binding_4" amino acids 9 to 144 (136 residues), 25.6 bits, see alignment E=3e-09 PF13460: NAD_binding_10" amino acids 11 to 150 (140 residues), 46.4 bits, see alignment E=2e-15 PF08485: Polysacc_syn_2C" amino acids 285 to 332 (48 residues), 81.9 bits, see alignment 9.7e-27

Best Hits

Swiss-Prot: 66% identical to CAPD_RICRS: UDP-glucose 4-epimerase (capD) from Rickettsia rickettsii (strain Sheila Smith)

KEGG orthology group: None (inferred from 92% identity to eoj:ECO26_2945)

MetaCyc: 80% identical to UDP-N-acetylglucosamine 4,6-dehydratase (configuration-inverting) (Pseudomonas aeruginosa O11)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>EFB2_01821 UDP-glucose 4-epimerase (Escherichia fergusonii Becca)
MFNGKILLITGGTGSFGNAVLRRFLDTDIKEIRIFSRDEKKQDDMRKKYNNPKLKFYIGD
VRDYSSILNASRGVDFIYHAAALKQVPSCEFHPMEAVKTNVLGTENVLEAAIANGVRRIV
CLSTDKAVYPINAMGISKAMMEKVMVAKSRNVDCSKTVICGTRYGNVMASRGSVIPLFVD
LIKSGRPMTITDPNMTRFMMTLEDAVDLVLYAFEHGNNGDIFVQKAPAATIETLAIALKE
LLNVNQHPVNIIGTRHGEKLYEALLSREEMIAAEDMGDYYRVPPDLRDLNYGKYVEHGDR
RISEVEDYNSHNTDRLDVEGMKKLLLKLPFIRALRSGEDYELDS