Protein Info for EFB2_01803 in Escherichia fergusonii Becca

Annotation: GDP-mannose mannosyl hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 21 to 143 (123 residues), 79.6 bits, E=1.2e-26

Best Hits

Swiss-Prot: 99% identical to GMM_ECO57: GDP-mannose mannosyl hydrolase (gmm) from Escherichia coli O157:H7

KEGG orthology group: K03207, colanic acid biosynthesis protein WcaH [EC: 3.6.1.-] (inferred from 98% identity to eco:b2051)

MetaCyc: 98% identical to GDP-mannose mannosyl hydrolase (Escherichia coli K-12 substr. MG1655)
GDP-glucosidase. [EC: 3.2.1.42]; 3.2.1.42 [EC: 3.2.1.42]

Predicted SEED Role

"GDP-mannose mannosyl hydrolase (EC 3.6.1.-)" in subsystem Colanic acid biosynthesis or Mannose Metabolism or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.2.1.42 or 3.6.1.-

Protein Sequence (160 amino acids)

>EFB2_01803 GDP-mannose mannosyl hydrolase (Escherichia fergusonii Becca)
MMFLRQEDFATVVRSTPLVSLDFIVENSRGEFLLGKRTNRPAQGYWFVPGGRVQKDETLE
AAFERLTMAELGLRLPITAGQFYGVWQHFYDDNFSGTDFTTHYVVLGFRFRVAEEELLLP
DEQHDDYRWLTPDALLASDNVHANSRAYFLAEKRAGVPGL