Protein Info for EFB2_01636 in Escherichia fergusonii Becca

Annotation: Signal transduction histidine-protein kinase AtoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 265 to 379 (115 residues), 58.6 bits, see alignment E=3.4e-20 PF00989: PAS" amino acids 265 to 369 (105 residues), 80.1 bits, see alignment E=3.8e-26 PF13188: PAS_8" amino acids 267 to 316 (50 residues), 24.8 bits, see alignment 4.6e-09 PF08448: PAS_4" amino acids 269 to 375 (107 residues), 39.2 bits, see alignment E=2.2e-13 PF13426: PAS_9" amino acids 273 to 372 (100 residues), 43.5 bits, see alignment E=1e-14 PF00512: HisKA" amino acids 389 to 451 (63 residues), 64.4 bits, see alignment E=2.4e-21 PF02518: HATPase_c" amino acids 496 to 600 (105 residues), 87.8 bits, see alignment E=2.1e-28

Best Hits

Swiss-Prot: 99% identical to ATOS_ECOLI: Signal transduction histidine-protein kinase AtoS (atoS) from Escherichia coli (strain K12)

KEGG orthology group: K07710, two-component system, NtrC family, sensor histidine kinase AtoS [EC: 2.7.13.3] (inferred from 100% identity to ecz:ECS88_2368)

MetaCyc: 99% identical to sensor histidine kinase AtoS (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensory histidine kinase AtoS" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (608 amino acids)

>EFB2_01636 Signal transduction histidine-protein kinase AtoS (Escherichia fergusonii Becca)
MHYMKWIYPRRLRNQMILMAILMVIVPTLTIGYIVETEGRSAVLSEKEKKLSAVVNLLNQ
ALGNRYDLYIDLPREERIRALNAELAPITENITHAFPGIGAGYYNKTLDAIITYAPSALY
QNNVGVTIAADHPGREVMRTNTPLVYSGRQVRGDILNSMIPIERNGEILGYIWANELTED
IRRQAWKMDARIIIVLTAGLLISLLLIVLFSRRLSANIDIITDGLSTLAQNIPTRLPQLP
GEMGQISQSVNNLAQALRETRTLNDLIIENAADGVIAIDRQGDVTTMNPAAEVITGYQRH
ELVGQPYSMLFDNTQFYSPVLDTLEHGTEHVALEISFPGRDRTIELSVTTSRIHNTHGEM
IGALVIFSDLTARKETQRRMAQAERLATLGELMAGVAHEVRNPLTAIRGYVQILRQQTRD
PIHQEYLSVVLKEIDSINKVIQQLLEFSRPRHSQWQQVSLNALVEETLVLVQTAGVQARV
DFISELDNELSPINADRELLKQVLLNILINAVQAISARGKIRIRTWQYSDSQQAISIEDN
GSGIDLSLQKKIFDPFFTTKASGTGLGLALSQRIINAHQGDIRVASLPGYGATFTLILPI
NPQGNQTV