Protein Info for EFB2_01632 in Escherichia fergusonii Becca

Annotation: Putative short-chain fatty acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 98 to 124 (27 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details amino acids 395 to 412 (18 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details PF02667: SCFA_trans" amino acids 1 to 440 (440 residues), 774.8 bits, see alignment E=1.6e-237 TIGR00366: TIGR00366 family protein" amino acids 4 to 428 (425 residues), 747.8 bits, see alignment E=2.3e-229

Best Hits

Swiss-Prot: 100% identical to ATOE_ECOLI: Putative short-chain fatty acid transporter (atoE) from Escherichia coli (strain K12)

KEGG orthology group: K02106, short-chain fatty acids transporter (inferred from 100% identity to eco:b2223)

MetaCyc: 100% identical to short chain fatty acid transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-281

Predicted SEED Role

"Short chain fatty acids transporter" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>EFB2_01632 Putative short-chain fatty acid transporter (Escherichia fergusonii Becca)
MIGRISRFMTRFVSRWLPDPLIFAMLLTLLTFVIALWLTPQTPISMVKMWGDGFWNLLAF
GMQMALIIVTGHALASSAPVKSLLRTAASAAKTPVQGVMLVTFFGSVACVINWGFGLVVG
AMFAREVARRVPGSDYPLLIACAYIGFLTWGGGFSGSMPLLAATPGNPVEHIAGLIPVGD
TLFSGFNIFITVALIVVMPFITRMMMPKPSDVVSIDPKLLMEEADFQKQLPKDAPPSERL
EESRILTLIIGALGIAYLAMYFSEHGFNITINTVNLMFMIAGLLLHKTPMAYMRAISAAA
RSTAGILVQFPFYAGIQLMMEHSGLGGLITEFFINVANKDTFPVMTFFSSALINFAVPSG
GGHWVIQGPFVMPAAQALGADLGKSVMAIAYGEQWMNMAQPFWALPALAIAGLGVRDIMG
YCITALLFSGVIFVIGLTLF