Protein Info for EFB2_01614 in Escherichia fergusonii Becca

Annotation: Anaerobic glycerol-3-phosphate dehydrogenase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 TIGR03379: glycerol-3-phosphate dehydrogenase, anaerobic, C subunit" amino acids 3 to 395 (393 residues), 765.5 bits, see alignment E=4.8e-235 PF13183: Fer4_8" amino acids 6 to 70 (65 residues), 44.8 bits, see alignment E=3.8e-15 PF12838: Fer4_7" amino acids 8 to 70 (63 residues), 28.3 bits, see alignment E=5e-10 PF13534: Fer4_17" amino acids 8 to 70 (63 residues), 31 bits, see alignment E=7.5e-11 PF02754: CCG" amino acids 163 to 249 (87 residues), 57.3 bits, see alignment E=3.5e-19 amino acids 293 to 376 (84 residues), 59 bits, see alignment E=1e-19

Best Hits

Swiss-Prot: 100% identical to GLPC_ECO57: Anaerobic glycerol-3-phosphate dehydrogenase subunit C (glpC) from Escherichia coli O157:H7

KEGG orthology group: K00113, glycerol-3-phosphate dehydrogenase subunit C [EC: 1.1.5.3] (inferred from 100% identity to eco:b2243)

MetaCyc: 100% identical to anaerobic glycerol-3-phosphate dehydrogenase subunit C (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase. [EC: 1.1.5.3]

Predicted SEED Role

"Anaerobic glycerol-3-phosphate dehydrogenase subunit C (EC 1.1.5.3)" in subsystem Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.3

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>EFB2_01614 Anaerobic glycerol-3-phosphate dehydrogenase subunit C (Escherichia fergusonii Becca)
MNDTSFENCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKDGALYDEALKYCINCK
RCEVACPSDVKIGDIIQRARAKYDTTRPSLRNFVLSHTDLMGSVSTPFAPIVNTATSLKP
VRQLLDAALKIDHRRTLPKYSFGTFRRWYRSVAAQQAQYKDQVAFFHGCFVNYNHPQLGK
DLIKVLNAMGTGVQLLSKEKCCGVPLIANGFTDKARKQAITNVESIREAVGVKGIPVIAT
SSTCTFALRDEYPEVLNVDNKGLRDHIELATRWLWRKLDEGKTLPLKPLPLKVVYHTPCH
MEKMGWTLYTLELLRKIPGLELTVLDSQCCGIAGTYGFKKENYPTSQAIGAPLFRQIEES
GADLVVTDCETCKWQIEMSTSLRCEHPITLLAQALA