Protein Info for EFB2_01444 in Escherichia fergusonii Becca

Annotation: N-acetylmuramoyl-L-alanine amidase AmiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF01520: Amidase_3" amino acids 59 to 273 (215 residues), 173.1 bits, see alignment E=2.9e-55

Best Hits

Swiss-Prot: 99% identical to AMIA_ECOLI: N-acetylmuramoyl-L-alanine amidase AmiA (amiA) from Escherichia coli (strain K12)

KEGG orthology group: K01448, N-acetylmuramoyl-L-alanine amidase [EC: 3.5.1.28] (inferred from 99% identity to ecj:JW2428)

MetaCyc: 99% identical to N-acetylmuramoyl-L-alanine amidase A (Escherichia coli K-12 substr. MG1655)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)" (EC 3.5.1.28)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>EFB2_01444 N-acetylmuramoyl-L-alanine amidase AmiA (Escherichia fergusonii Becca)
MSTFKPLKTLTSRRQVLKAGLAALTLSGMSQAIAKEEPLKTSNGHSKPKAKKSGGRRVVV
LDPGHGGIDTGAIGRNGSKEKHVVLAIAKNVRSILRNHGIDARLTRSGDTFIPLYDRVEI
AHKHGADLFMSIHADGFTNPKAAGASVFALSNRGASSAMAKYLSERENRADEVAGKKATD
KDHLLQQVLFDLVQTDTIKNSLTLGSHILKKIKPVHKLHSRNTEQAAFVVLKSPSVPSVL
VETSFITNPEEERLLGTAAFRQKIATAIAEGVISYFHWFDNQKAHSRKR