Protein Info for EFB2_01179 in Escherichia fergusonii Becca

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 855 TIGR01070: DNA mismatch repair protein MutS" amino acids 12 to 852 (841 residues), 1388.7 bits, see alignment E=0 PF01624: MutS_I" amino acids 13 to 124 (112 residues), 148.7 bits, see alignment E=1.8e-47 PF05188: MutS_II" amino acids 133 to 258 (126 residues), 129.5 bits, see alignment E=2.9e-41 PF05192: MutS_III" amino acids 274 to 561 (288 residues), 174.7 bits, see alignment E=7.6e-55 PF05190: MutS_IV" amino acids 430 to 519 (90 residues), 104.2 bits, see alignment E=9.3e-34 PF00488: MutS_V" amino acids 612 to 799 (188 residues), 299 bits, see alignment E=4.1e-93

Best Hits

Swiss-Prot: 99% identical to MUTS_ECO24: DNA mismatch repair protein MutS (mutS) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 100% identity to ecx:EcHS_A2871)

MetaCyc: 100% identical to DNA mismatch repair protein MutS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (855 amino acids)

>EFB2_01179 DNA mismatch repair protein MutS (Escherichia fergusonii Becca)
MQESIDKDLSNHTPMMQQYLKLKAQHPEILLFYRMGDFYELFYDDAKRASQLLDISLTKR
GASAGEPIPMAGIPYHAVENYLAKLVNQGESVAICEQIGDPATSKGPVERKVVRIVTPGT
ISDEALLQERQDNLLAAIWQDSKGFGYATLDISSGRFRLSEPADRETMAAELQRTNPAEL
LYAEDFAEMSLIEGRRGLRRRPLWEFEIDTARQQLNLQFGTRDLVGFGVENAPRGLCAAG
CLLQYAKDTQRTTLPHIRSITMERQQDSIIMDAATRRNLEITQNLAGGAENTLASVLDCT
VTPMGSRMLKRWLHMPVRDTRVLLERQQTIGALQDFTAELQPVLRQVGDLERILARLALR
TARPRDLARMRHAFQQLPELRAQLENVDSAPVQALREKMGEFAELRDLLERAIIDTPPVL
VRDGGVIASGYNEELDEWRALADGATDYLERLEVRERERTGLDTLKVGFNAVHGYYIQIS
RGQSHLAPINYMRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKQLYEELFDLLLPH
LEALQQSASALAELDVLVNLAERAYTLNYTCPTFIDKPGIRITEGRHPVVEQVLNEPFIA
NPLNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGPIDRIFTRVG
AADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACAENLANK
IKALTLFATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDGAASKSYGLAVAAL
AGVPKEVIKRARQKLRELESISPNAAATQVDGTQMSLLSVPEETSPAVEALENLDPDSLT
PRQALEWIYRLKSLV