Protein Info for EFB2_01120 in Escherichia fergusonii Becca

Annotation: L-serine dehydratase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 TIGR00720: L-serine ammonia-lyase" amino acids 2 to 451 (450 residues), 738.2 bits, see alignment E=1.8e-226 PF03315: SDH_beta" amino acids 3 to 155 (153 residues), 197.7 bits, see alignment E=1.5e-62 PF03313: SDH_alpha" amino acids 183 to 448 (266 residues), 296.8 bits, see alignment E=1.6e-92

Best Hits

Swiss-Prot: 100% identical to SDHM_ECOLI: L-serine dehydratase 2 (sdaB) from Escherichia coli (strain K12)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 100% identity to eco:b2797)

MetaCyc: 100% identical to L-serine deaminase II (Escherichia coli K-12 substr. MG1655)
L-serine ammonia-lyase. [EC: 4.3.1.17]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>EFB2_01120 L-serine dehydratase 2 (Escherichia fergusonii Becca)
MISVFDIFKIGIGPSSSHTVGPMKAGKQFTDDLIARNLLKDVTRVVVDVYGSLSLTGKGH
HTDIAIIMGLAGNLPDTVDIDSIPGFIQDVNTHGRLMLANGQHEVEFPVDQCMNFHADNL
SLHENGMRITALAGDKVVYSQTYYSIGGGFIVDEEHFGQQDSAPVEVPYPYSSAADLQKH
CQETGLSLSGLMMKNELALHSKEELEQHLANVWEVMRGGIERGISTEGVLPGKLRVPRRA
AALRRMLVSQDKTTTDPMAVVDWINMFALAVNEENAAGGRVVTAPTNGACGIIPAVLAYY
DKFIREVNANSLARYLLVASAIGSLYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGA
SPAQVCIAAEIAMEHNLGLTCDPVAGQVQVPCIERNAIAAVKAVNAARMALRRTSEPRVC
LDKVIETMYETGKDMNAKYRETSRGGLAMKIVACD