Protein Info for EFB2_01034 in Escherichia fergusonii Becca

Annotation: Nicotinate dehydrogenase FAD-subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF00941: FAD_binding_5" amino acids 6 to 173 (168 residues), 174.8 bits, see alignment E=1.5e-55 PF03450: CO_deh_flav_C" amino acids 183 to 283 (101 residues), 96.3 bits, see alignment E=1.1e-31

Best Hits

Swiss-Prot: 97% identical to XDHB_ECOLI: Putative xanthine dehydrogenase FAD-binding subunit XdhB (xdhB) from Escherichia coli (strain K12)

KEGG orthology group: K13479, xanthine dehydrogenase FAD-binding subunit [EC: 1.17.1.4] (inferred from 100% identity to ecg:E2348C_3119)

MetaCyc: 97% identical to putative xanthine dehydrogenase FAD-binding subunit XdhB (Escherichia coli K-12 substr. MG1655)
Xanthine dehydrogenase. [EC: 1.17.1.4]; 1.17.1.4 [EC: 1.17.1.4]

Predicted SEED Role

"Xanthine dehydrogenase, FAD binding subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>EFB2_01034 Nicotinate dehydrogenase FAD-subunit (Escherichia fergusonii Becca)
MFDFASYHRATTLADAITLLADNPQAKLLAGGTDVLIQLHHHNDRYRHIVDIHNLAELRG
ITQAEDGALRIGSATTFTQLIEDPVIQRNLPALCAAAASIAGPQIRNVATYGGNICNGAT
SADSATPTLIYDAKLELHSPRGVRFVPINGFHTGPGKVSLEHDEILVAFHFPPQPKEHAG
SAHFKYAMRDAMDISTIGCAAHCRLDNGNFSELRLAFGVAAPTPIRCQHAEQTAQNAPLN
LQTLEAISESVLQDVAPRSSWRASKEFRLHLIQTMTKKVISEAVAAAGGKLQ