Protein Info for EFB2_00982 in Escherichia fergusonii Becca

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 96 to 125 (30 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 16 to 64 (49 residues), 50 bits, see alignment 4.5e-17 PF21088: MS_channel_1st" amino acids 72 to 112 (41 residues), 35.4 bits, see alignment 1.6e-12 PF00924: MS_channel_2nd" amino acids 114 to 180 (67 residues), 77.5 bits, see alignment E=1.3e-25 PF21082: MS_channel_3rd" amino acids 187 to 268 (82 residues), 77.5 bits, see alignment E=1.7e-25

Best Hits

Swiss-Prot: 99% identical to MSCS_ECOLI: Small-conductance mechanosensitive channel (mscS) from Escherichia coli (strain K12)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 99% identity to eco:b2924)

MetaCyc: 99% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Protein involved in stability of MscS mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>EFB2_00982 Small-conductance mechanosensitive channel (Escherichia fergusonii Becca)
MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK
IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA
GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR
EPARRNEFIIGVAYDSDIDQVKQILTDIIQSEDRILKDREMTVRLNELGASSINFVVRVW
SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA