Protein Info for EFB2_00965 in Escherichia fergusonii Becca

Annotation: Metalloprotease LoiP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF01435: Peptidase_M48" amino acids 82 to 245 (164 residues), 90.4 bits, see alignment E=6.9e-30

Best Hits

Swiss-Prot: 95% identical to LOIP_ECOLI: Metalloprotease LoiP (loiP) from Escherichia coli (strain K12)

KEGG orthology group: K07387, putative metalloprotease [EC: 3.4.24.-] (inferred from 100% identity to ecq:ECED1_3398)

MetaCyc: 95% identical to metalloprotease LoiP (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"Putative metalloprotease yggG (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>EFB2_00965 Metalloprotease LoiP (Escherichia fergusonii Becca)
MKIRALLVAMSVATVLTGCQNMDSSGLLSSGAEAFQAYSLSDAQVKKLSDQACQEMDSKA
TIAPANSEYARRLTTISRALGDNINGQPVNYKVYMAKDVNAFAMANGCIRVYSGLMDMMT
DNEVEAVLGHEMGHVALGHVKKGMQVALGTNAIRVAAASAGGIVGSLSQSQLGDLGEKLV
NSQFTQRQESEADDYSYDLLRQRGISPAGLATSFEKLAKLEEGRQSSMFDDHPASAERAQ
HIRDRMSADGVK