Protein Info for EFB2_00781 in Escherichia fergusonii Becca

Annotation: putative siderophore transport system permease protein YfiZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 60 to 81 (22 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 237 to 261 (25 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details PF01032: FecCD" amino acids 14 to 323 (310 residues), 298.2 bits, see alignment E=3.2e-93

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 99% identity to ecf:ECH74115_4341)

Predicted SEED Role

"Putative iron compound permease protein of ABC transporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>EFB2_00781 putative siderophore transport system permease protein YfiZ (Escherichia fergusonii Becca)
MMRTGLVTVIFLALLLVGCVVYPGIGARFIAPQTVLQAFLHFDPQNFDHNVIVRLRLPRL
AAALLTGASLGVAGALLQAVIRNPLGEPHILGLNAGAALAVVAASALGLAFPVGRPLLAS
TGGALLFLLILLLSSAGRSGVTPMKVTLCGVALSAFVSSITAAILILDEQTLLAMRTWLA
GDLAGQDWATLGTSAWFSLGGFVLALYLAPSLNMLALGDRMAQGLGVSVLRTRTFTLLAI
ALLCGAAVSIAGPIGFVGLLVPQIVRRLVSADLRVLLPLSACVGALLLLLADIIARTLFT
PHELATGVMTALVGAPVFVIMATRMFK