Protein Info for EFB2_00570 in Escherichia fergusonii Becca

Annotation: D-tagatose-1,6-bisphosphate aldolase subunit GatY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00167: ketose-bisphosphate aldolase" amino acids 1 to 283 (283 residues), 333.9 bits, see alignment E=8.5e-104 TIGR01858: class II aldolase, tagatose bisphosphate family" amino acids 3 to 284 (282 residues), 476.4 bits, see alignment E=2.4e-147 PF01116: F_bP_aldolase" amino acids 5 to 283 (279 residues), 335.6 bits, see alignment E=1.4e-104

Best Hits

Swiss-Prot: 71% identical to GATY_SALTI: D-tagatose-1,6-bisphosphate aldolase subunit GatY (gatY) from Salmonella typhi

KEGG orthology group: K08302, tagatose 1,6-diphosphate aldolase [EC: 4.1.2.40] (inferred from 99% identity to sbc:SbBS512_E3636)

MetaCyc: 64% identical to tagatose-1,6-bisphosphate aldolase 2 (Escherichia coli K-12 substr. MG1655)
Tagatose-bisphosphate aldolase. [EC: 4.1.2.40]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.40

Use Curated BLAST to search for 4.1.2.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>EFB2_00570 D-tagatose-1,6-bisphosphate aldolase subunit GatY (Escherichia fergusonii Becca)
MYIISSKNMLKKAQSEGYAVPAFNIHNLETLQVVVESAAQLRSPVMLAGTPGTYRYGGVG
SLISLVQSLAREYNLPLVLHLDHHEESDDIFNKVRAGIRSVMIDGSHLPFEDNIARVQEV
TTFCHRFDVSVEAELGRLGGQEDDLRVDEKDSAYTSPAAAAEFVQRTQIDSLAVAIGTAH
GLYAHEPRLDFVRLEQIRQRVEIPLVLHGASGLSEQDVQHCIRRGICKVNVATELKIAFA
DALKGYFYNNPAANDPRHYMQPAKAAMKEVVIRIIGVCGSEGKI