Protein Info for EFB2_00492 in Escherichia fergusonii Becca

Annotation: Putative type II secretion system protein J

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details PF07963: N_methyl" amino acids 3 to 28 (26 residues), 35.3 bits, see alignment (E = 5.8e-13) TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 5 to 27 (23 residues), 31.8 bits, see alignment (E = 8.5e-12) PF11612: T2SSJ" amino acids 58 to 172 (115 residues), 30.6 bits, see alignment E=3.7e-11

Best Hits

Swiss-Prot: 97% identical to GSPJ_ECOLI: Putative type II secretion system protein J (gspJ) from Escherichia coli (strain K12)

KEGG orthology group: K02459, general secretion pathway protein J (inferred from 100% identity to ecc:c4102)

MetaCyc: 97% identical to type II secretion system protein GspJ (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein J"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>EFB2_00492 Putative type II secretion system protein J (Escherichia fergusonii Becca)
MINRQQGFTLLEVMAALAIFSMLSVLAFMIFSQVSELHQRSQKEIQKFNQLQRTITILDN
DLLQLVARRNRSTDKIMVLGEEAIFTTQSRDPLAPLSEAQTLLTVHWYLRNHTLYRAVRT
SVDGRKDHPAQAMLEHVESFLLESNSGESQELPLSVTLHLKTQQYGALQRRFALPEQLAR
EESPAQTQAGNNNHE