Protein Info for EFB2_00451 in Escherichia fergusonii Becca

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 49 to 70 (22 residues), see Phobius details amino acids 77 to 82 (6 residues), see Phobius details amino acids 86 to 115 (30 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 289 to 315 (27 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 370 to 397 (28 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details PF10797: YhfT" amino acids 6 to 431 (426 residues), 601.7 bits, see alignment E=4.5e-185

Best Hits

Swiss-Prot: 99% identical to YHFT_ECOLI: Uncharacterized protein YhfT (yhfT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b3377)

Predicted SEED Role

"FIG006427: Putative transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>EFB2_00451 hypothetical protein (Escherichia fergusonii Becca)
MDLYIQIIVVACLTGMTSLLAHRSAAVFHDGIRPILPQLIEGYMNRREAGSIAFGLSIGF
VASVGISFTLKTGLLNAWLLFLPTDILGVLAINSLMAFGLGAIWGILILTCLLPVNQLLT
ALPVDVLGSLGELSSPVVSAFALFPLVAIFYQFGWKQSLIAAVVVLMTRVVVVRYFPHLN
PESIEIFIGMVMLLGIAITHDLRHRDENDIDASGMSVFEERTSRIIKNLPYIAIVGALIA
AVASMKIFAGSEVSIFTLEKAYSAGVTPEQSQTLINQAALAEFMRGLGFVPLIATTALAT
GVYAVAGFTFVYAVGYLSPNPMVAAVLGAVVISAEVLLLRSIGKWLGRYPSVRNASDNIR
NAMNMLMEVALLVGSIFAAIKMAGYTGFSIAVAIYFLNESLGRPVQKMAAPVVAVMITGI
LLNVLYWLGLFVPA