Protein Info for EFB2_00405 in Escherichia fergusonii Becca

Annotation: Rhomboid protease GlpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 94 to 113 (20 residues), see Phobius details amino acids 133 to 158 (26 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 223 to 240 (18 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details PF12122: Rhomboid_N" amino acids 2 to 80 (79 residues), 104.2 bits, see alignment E=3.7e-34 TIGR04239: rhomboid family protease GlpG" amino acids 2 to 267 (266 residues), 389.5 bits, see alignment E=5.2e-121 PF01694: Rhomboid" amino acids 131 to 266 (136 residues), 108.3 bits, see alignment E=3.8e-35

Best Hits

Swiss-Prot: 100% identical to GLPG_ECO7I: Rhomboid protease GlpG (glpG) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K02441, GlpG protein (inferred from 99% identity to eco:b3424)

MetaCyc: 99% identical to rhomboid protease GlpG (Escherichia coli K-12 substr. MG1655)
Rhomboid protease. [EC: 3.4.21.105]

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.105

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>EFB2_00405 Rhomboid protease GlpG (Escherichia fergusonii Becca)
MITSFANPRVAQAFVDYMATQGVILTIQQNNQSDVWLADESQAERVRAELARFLENPADP
RYLAASWQSGHTDSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVMLW
LAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISA
LLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWF
DLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK