Protein Info for EFB2_00359 in Escherichia fergusonii Becca

Annotation: PTS system sorbose-specific EIIC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 36 to 41 (6 residues), see Phobius details amino acids 45 to 57 (13 residues), see Phobius details amino acids 92 to 107 (16 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 207 to 237 (31 residues), see Phobius details PF03609: EII-Sor" amino acids 4 to 234 (231 residues), 241 bits, see alignment E=5.9e-76

Best Hits

KEGG orthology group: K02795, PTS system, mannose-specific IIC component (inferred from 100% identity to eci:UTI89_C3972)

MetaCyc: 47% identical to D-glucosaminate PTS permease components EIIC (Salmonella enterica enterica serovar Typhimurium str. 14028S)
RXN-14729 [EC: 2.7.1.203]

Predicted SEED Role

"PTS system, gluconate-specific IIC component (EC 2.7.1.69)" (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.203 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>EFB2_00359 PTS system sorbose-specific EIIC component (Escherichia fergusonii Becca)
MSIFTAAMIALVYWISQAKVWYGFSIMRMPLSIAPIMGLIFNDMPTALSVGATLQMIYIG
SIAPGGNPPADEGLASCIAIPIALTAGIKPEIAISLAIPLGLLGVVLENVRKTLNTTFIH
MADRYAEKGDIKGIQRAATIYPLLLAFPMRFVPVFIACLYGPDAIASFVNLLPAWSTNGL
AIAGNILPALGFAITIIVIGKKQYIPLFIIGFFLVTYSGLNTIGISIFGLCAVLLYMQSQ
NTKGTKNG