Protein Info for EFB2_00354 in Escherichia fergusonii Becca

Annotation: Cell division protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 72 to 95 (24 residues), see Phobius details amino acids 214 to 242 (29 residues), see Phobius details amino acids 271 to 296 (26 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details TIGR00439: putative protein insertion permease FtsX" amino acids 47 to 352 (306 residues), 534.3 bits, see alignment E=4.4e-165 PF18075: FtsX_ECD" amino acids 110 to 204 (95 residues), 57.3 bits, see alignment E=2e-19 PF02687: FtsX" amino acids 227 to 341 (115 residues), 51.7 bits, see alignment E=8.3e-18

Best Hits

Swiss-Prot: 100% identical to FTSX_ECOL6: Cell division protein FtsX (ftsX) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 100% identity to eco:b3462)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>EFB2_00354 Cell division protein FtsX (Escherichia fergusonii Becca)
MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAF
HGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLD
DDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKL
DFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI
GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSS
AVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE