Protein Info for EFB2_00229 in Escherichia fergusonii Becca

Annotation: 2,3-diketo-L-gulonate TRAP transporter small permease protein YiaM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details PF04290: DctQ" amino acids 17 to 145 (129 residues), 102.8 bits, see alignment E=6.8e-34

Best Hits

Swiss-Prot: 74% identical to YIAM_ECOLI: 2,3-diketo-L-gulonate TRAP transporter small permease protein YiaM (yiaM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ecz:ECS88_3997)

MetaCyc: 74% identical to 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"2,3-diketo-L-gulonate TRAP transporter small permease protein yiaM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>EFB2_00229 2,3-diketo-L-gulonate TRAP transporter small permease protein YiaM (Escherichia fergusonii Becca)
MKRILEGILAIIIAILSCIIFINIILRYGFHTSILSIDELSRLLFVWLTFIGAIVAYMDN
SHVQVTFLVEKLSPANQQRVSLLTHTLILLLCLGLAWGAIEKTAQDWSNLSPILGVPVGL
MYAAAIPTSLIIALLELRHLYRQFTNTPSRNQQGA