Protein Info for EFB2_00228 in Escherichia fergusonii Becca

Annotation: Sialic acid TRAP transporter large permease protein SiaM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 6 to 34 (29 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 94 to 124 (31 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 240 to 256 (17 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 314 to 343 (30 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details amino acids 396 to 418 (23 residues), see Phobius details PF06808: DctM" amino acids 7 to 416 (410 residues), 459.8 bits, see alignment E=4.1e-142 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 419 (403 residues), 505.7 bits, see alignment E=4.3e-156

Best Hits

Swiss-Prot: 85% identical to YIAN_ECOLI: 2,3-diketo-L-gulonate TRAP transporter large permease protein YiaN (yiaN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecg:E2348C_3831)

MetaCyc: 85% identical to 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"2,3-diketo-L-gulonate TRAP transporter large permease protein yiaN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>EFB2_00228 Sialic acid TRAP transporter large permease protein SiaM (Escherichia fergusonii Becca)
MTILIFIVSLLGAIAIGVPIAWALLLCGISLMFWMDIFDVQILAQTLVNGADSFSLLAIP
FFVLAGEIMNAGGLSQRIVDLPMKLVGHRPGGLGYVGVLAAMIMASLSGSAVADTAAVAA
LLVPMMRQANYPVNRAAGLIGSGGIIAAIIPPSIPLIIFGVSSGLSISKLFMAGIAPGIM
MGVTLMVTWWWQAKRLNLPCQPKASLREVWQSLVSGIWALFLPIIIIGGFRSGLFTPTEA
GAVAAFYALFVSVVVYREMTFSTLYHVLINAAKTTSVVMFLVASAAVSAWLITIAELPMM
VSELLQPLVDSPRLLFIVIMLAIMVISTVMDLTPTVLILTPVLMPLVKEAGIDPVYFGIM
FIINCSISLITPPVGNVLNVVCGVAKLKFDDAVKGVAPYVMVLFMLLALFIFIPELITAP
LKWMS