Protein Info for EFB2_00172 in Escherichia fergusonii Becca
Annotation: Nucleoid occlusion factor SlmA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to SLMA_ECO45: Nucleoid occlusion factor SlmA (slmA) from Escherichia coli O45:K1 (strain S88 / ExPEC)
KEGG orthology group: K05501, TetR/AcrR family transcriptional regulator (inferred from 100% identity to eco:b3641)Predicted SEED Role
"Transcriptional regulator SlmA, TetR family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (198 amino acids)
>EFB2_00172 Nucleoid occlusion factor SlmA (Escherichia fergusonii Becca) MAEKQTAKRNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFD SLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRILTGHALMFEQDR LQGRINQLFERIEAQLRQVLREKRMREGEGYATDETLLASQILAFCEGMLSRFVRSEFKY RPTDDFDARWPLIAAQLQ