Protein Info for EFB2_00137 in Escherichia fergusonii Becca

Annotation: tRNA (guanosine(18)-2'-O)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 138 to 159 (22 residues), see Phobius details PF00588: SpoU_methylase" amino acids 20 to 159 (140 residues), 134.8 bits, see alignment E=2.5e-43 PF12105: SpoU_methylas_C" amino acids 163 to 218 (56 residues), 83.8 bits, see alignment E=5.3e-28

Best Hits

Swiss-Prot: 100% identical to TRMH_ECOLI: tRNA (guanosine(18)-2'-O)-methyltransferase (trmH) from Escherichia coli (strain K12)

KEGG orthology group: K00556, tRNA (guanosine-2'-O-)-methyltransferase [EC: 2.1.1.34] (inferred from 100% identity to eco:b3651)

MetaCyc: 100% identical to tRNA (Gm18) 2'-O-methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA guanosine-2'-O-methyltransferase. [EC: 2.1.1.34]

Predicted SEED Role

"tRNA (guanosine(18)-2'-O)-methyltransferase (EC 2.1.1.34)" (EC 2.1.1.34)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>EFB2_00137 tRNA (guanosine(18)-2'-O)-methyltransferase (Escherichia fergusonii Becca)
MNPTRYARICEMLARRQPDLTVCMEQVHKPHNVSAIIRTADAVGVHEVHAVWPGSRMRTM
ASAAAGSNSWVQVKTHRTIGDAVAHLKGQGMQILATHLSDNAVDFREIDYTRPTCILMGQ
EKTGITQEALALADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQNAGMYLRENSMLPE
AEQQRLLFEGGYPVLAKVAKRKGLPYPHVNQQGEIEADADWWSTMQAAG