Protein Info for EFB2_00131 in Escherichia fergusonii Becca
Annotation: Fructokinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 98% identity to ecm:EcSMS35_3992)Predicted SEED Role
"ROK family Glucokinase with ambiguous substrate specificity"
MetaCyc Pathways
- superpathway of anaerobic sucrose degradation (17/19 steps found)
- heterolactic fermentation (16/18 steps found)
- sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
- D-sorbitol degradation I (3/3 steps found)
- mannitol cycle (4/5 steps found)
- sucrose degradation II (sucrose synthase) (4/5 steps found)
- sucrose degradation III (sucrose invertase) (3/4 steps found)
- sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
- sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.7.1.4
Use Curated BLAST to search for 2.7.1.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (310 amino acids)
>EFB2_00131 Fructokinase (Escherichia fergusonii Becca) MHYLGLDIGGTKIAAVVMDAHGWEIRRYRCPTQKSTYQQFVSCVVALIEQIRRDVQRPML TGIALPGSISPLTGLIKNANIQVINGHALQADLQQLLGQPVVIANDGNCFALSEACDGAG QDYDVVFGITLGTGCGGGIAIKQRPFIGAWGNAAECGHITLPGYTEQEDGPSVSCYCGKH NCVESFVSGSGFSERYQQMTGNLLTPAAIVTLAQRGDACAMQQVARFRQQLARTLATIVN VVDPGVIVIGGGLSNVELLITDLNAEVAPLVFTDQFTTPIVKAQHGDSSGMRGAAWLAMR NGEANETFTN