Protein Info for EFB2_00114 in Escherichia fergusonii Becca

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR04416: group II intron reverse transcriptase/maturase" amino acids 11 to 376 (366 residues), 392.6 bits, see alignment E=8.5e-122 PF00078: RVT_1" amino acids 67 to 285 (219 residues), 140 bits, see alignment E=8.7e-45 PF08388: GIIM" amino acids 311 to 385 (75 residues), 52.4 bits, see alignment E=4.1e-18

Best Hits

KEGG orthology group: None (inferred from 99% identity to ecq:ECED1_4889)

Predicted SEED Role

"Retron-type RNA-directed DNA polymerase (EC 2.7.7.49)" (EC 2.7.7.49)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>EFB2_00114 hypothetical protein (Escherichia fergusonii Becca)
MQRKSFEIPKALVWASYLDVRRNKGAPGCDGQTLKMFDQQRDGNLYKIWNRLCSGTWFPP
PVLEKRIPKSNGKERILGIPTVSDRIAQGAIKLFMEEKLDPIFHADSYGYRPGKSAHDAL
KQCAIRCWRYSWILEVDISAFFDHVRHDLVLKALEHHGMPKWVILYCRRWMEAPMQSCEN
GELITRTRGTPQGGVISPLLANLFLHYAFDLWMEREYRGVPFERYADDIVVHCSRMSDAT
RLKNRLSERFSEVGLVLNAGKTNIAYIDTFKRRNVATSFTFLGYDFKVRTLKNFKGELYR
KCMPGASNAAMRKITETIKKWRIHRSTAESLLDFARRYNAIVRGWIGYYGKFWSRNFNYR
LWSAMQSRLLKWMQSKYRLSNRKAQRKLTLVRKEYPKLFVHWYLLRASNE