Protein Info for ECD_10051 in Escherichia coli BL21

Annotation: tail component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR01600: phage minor tail protein L" amino acids 12 to 230 (219 residues), 329.4 bits, see alignment E=4.3e-103 PF05100: Phage_tail_L" amino acids 29 to 230 (202 residues), 338 bits, see alignment E=7.8e-106

Best Hits

Swiss-Prot: 100% identical to TIPL_LAMBD: Tail tip protein L (L) from Escherichia phage lambda

KEGG orthology group: None (inferred from 97% identity to eoj:ECO26_0621)

Predicted SEED Role

"Phage minor tail protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>ECD_10051 tail component (Escherichia coli BL21)
MQDIRQETLNECTRAEQSASVVLWEIDLTEVGGERYFFCNEQNEKGEPVTWQGRQYQPYP
IQGSGFELNGKGTSTRPTLTVSNLYGMVTGMAEDMQSLVGGTVVRRKVYARFLDAVNFVN
GNSYADPEQEVISRWRIEQCSELSAVSASFVLSTPTETDGAVFPGRIMLANTCTWTYRGD
ECGYSGPAVADEYDQPTSDITKDKCSKCLSGCKFRNNVGNFGGFLSINKLSQ