Protein Info for ECD_10035 in Escherichia coli BL21

Annotation: DNA packaging protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF07471: Phage_Nu1" amino acids 1 to 164 (164 residues), 333.2 bits, see alignment E=1.1e-104

Best Hits

Swiss-Prot: 100% identical to TERS_LAMBD: Terminase small subunit (Nu1) from Escherichia phage lambda

KEGG orthology group: None (inferred from 98% identity to eco:b0560)

Predicted SEED Role

"Terminase small subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>ECD_10035 DNA packaging protein (Escherichia coli BL21)
MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENE
KLRREVEELRQASEADLQPGTIEYERHRLTRAQADAQELKNARDSAEVVETAFCTFVLSR
IAGEIASILDGLPLSVQRRFPELENRHVDFLKRDIIKAMNKAAALDELIPGLLSEYIEQS
G