Protein Info for ECD_04284 in Escherichia coli BL21

Annotation: IS150 putative transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF13276: HTH_21" amino acids 43 to 96 (54 residues), 60.8 bits, see alignment E=2.9e-20 PF00665: rve" amino acids 119 to 217 (99 residues), 101.7 bits, see alignment E=6.3e-33 PF13610: DDE_Tnp_IS240" amino acids 123 to 261 (139 residues), 27.9 bits, see alignment E=6.5e-10 PF13683: rve_3" amino acids 205 to 271 (67 residues), 47.7 bits, see alignment E=2.5e-16 PF13333: rve_2" amino acids 224 to 278 (55 residues), 77 bits, see alignment E=2.5e-25

Best Hits

Swiss-Prot: 100% identical to INSK_ECOLI: Putative transposase InsK for insertion sequence element IS150 (insK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3558)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>ECD_04284 IS150 putative transposase (Escherichia coli BL21)
MKVLNELRQFYPLDELLRAAEIPRSTFYYHLKALSKPDKYADVKKRISEIYHENRGRYGY
RRVTLSLHREGKQINHKAVQRLMGTLSLKAAIKVKRYRSYRGEVGQTAPNVLQRDFKATR
PNEKWVTDVTEFAVNGRKLYLSPVIDLFNNEVISYSLSERPVMNMVENMLDQAFKKLNPH
EHPVLHSDQGWQYRMRRYQNILKEHGIKQSMSRKGNCLDNAVVECFFGTLKSECFYLDEF
SNISELKDAVTEYIEYYNSRRISLKLKGLTPIEYRNQTYMPRV