Protein Info for ECD_04263 in Escherichia coli BL21

Annotation: SMP_2 family putative membrane-anchored periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10144: SMP_2
  • amino acids 1 to 160 (160 residues), 231.2 bits, E=2.5e-73

Best Hits

Swiss-Prot: 100% identical to SMP_ECOLI: Probable inner membrane protein Smp (ytjB) from Escherichia coli (strain K12)

KEGG orthology group: K07186, membrane protein (inferred from 100% identity to eco:b4387)

Predicted SEED Role

"Lipoate-protein ligase A" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate salvage I (1/2 steps found)
• lipoate salvage II (1/4 steps found)

Protein Sequence (214 amino acids)

>ECD_04263 SMP_2 family putative membrane-anchored periplasmic protein (Escherichia coli BL21)
MARTKLKFRLHRAVIVLFCLALLVALMQGASWFSQNHQRQRNPQLEELARTLARQVTLNV
APLMRTDSPDEKRIQAILDQLTDESRILDAGVYDEQGDLIARSGESVEVRDRLALDGKKA
GGYFNQQIVEPIAGKNGPLGYLRLTLDTHTLATEAQQVDNTTNILRLMLLLSLAIGVVLT
RTLLQGKRTRWQQSPFLLTASKPVPEEEESEKKE