Protein Info for ECD_04255 in Escherichia coli BL21

Annotation: putative pyruvate formate lyase activating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR04041: glycine radical enzyme activase, YjjW family" amino acids 5 to 282 (278 residues), 396.2 bits, see alignment E=3.9e-123 PF13353: Fer4_12" amino acids 17 to 43 (27 residues), 25.3 bits, see alignment (E = 3.5e-09) PF04055: Radical_SAM" amino acids 28 to 231 (204 residues), 54.2 bits, see alignment E=4.1e-18 PF00037: Fer4" amino acids 44 to 62 (19 residues), 22.8 bits, see alignment (E = 1.3e-08) PF13187: Fer4_9" amino acids 46 to 90 (45 residues), 30.7 bits, see alignment 5.3e-11

Best Hits

Swiss-Prot: 100% identical to YJJW_ECOLI: Putative glycyl-radical enzyme activating enzyme YjjW (yjjW) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4379)

Predicted SEED Role

"radical activating enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>ECD_04255 putative pyruvate formate lyase activating enzyme (Escherichia coli BL21)
MNSRCALVSKIIPFSCVDGPGSRLALFLQGCNLRCKNCHNPWTMGRCNDCGECVPQCPHQ
ALQIVDGKVVWNAVVCEQCDTCLKRCPQHATPMAQSMSVDEVLSHVRKAVLFIEGITVSG
GEATTQLPFVVALFTAIKNDPQLRHLTCLVDSNGMLSETGWEKLLPVCDGAMLDLKAWGS
ECHQQLTGRDNQQIKRSIYLLAERGKLAELRLLVIPGQVDYLQHIEELAAFIKGLGDVPV
RLNAFHAHGVYGEAQSWASATPEDVEPLADALKVRGVSRLIFPALYL