Protein Info for ECD_04159 in Escherichia coli BL21

Annotation: RNA polymerase sigma-19 factor, fec operon-specific; ECF sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 13 to 164 (152 residues), 75.2 bits, see alignment E=2.4e-25 PF04542: Sigma70_r2" amino acids 16 to 81 (66 residues), 49 bits, see alignment E=8.5e-17 PF07638: Sigma70_ECF" amino acids 42 to 158 (117 residues), 21.4 bits, see alignment E=4.1e-08 PF08281: Sigma70_r4_2" amino acids 112 to 164 (53 residues), 56.7 bits, see alignment E=2.9e-19 PF04545: Sigma70_r4" amino acids 118 to 163 (46 residues), 31.9 bits, see alignment E=1.5e-11

Best Hits

Swiss-Prot: 100% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to eco:b4293)

MetaCyc: 100% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor FecI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>ECD_04159 RNA polymerase sigma-19 factor, fec operon-specific; ECF sigma factor (Escherichia coli BL21)
MSDRATTTASLTFESLYGTHHGWLKSWLTRKLQSAFDADDIAQDTFLRVMVSETLSTIRD
PRSFLCTIAKRVMVDLFRRNALEKAYLEMLALMPEGGAPSPEERESQLETLQLLDSMLDG
LNGKTREAFLLSQLDGLTYSEIAHKLGVSISSVKKYVAKAVEHCLLFRLEYGL